General Information

  • ID:  hor005218
  • Uniprot ID:  C0HJJ6
  • Protein name:  Glucagon-5
  • Gene name:  NA
  • Organism:  Huso dauricus (Kaluga sturgeon) (Acipenser dauricus)
  • Family:  Glucagon family
  • Source:  animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Huso (genus), Husinae (subfamily), Acipenseridae (family), Acipenseroidei (suborder), Acipenseriformes (order), Chondrostei (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSQGMFTNDYSKYLEEKLAQEFVEWLKNGKS
  • Length:  31
  • Propeptide:  HSQGMFTNDYSKYLEEKLAQEFVEWLKNGKS
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-C0HJJ6-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    AF-C0HJJ6-F1.pdbhor005218_AF2.pdbhor005218_ESM.pdb

Physical Information

Mass: 424339 Formula: C167H248N42O52S
Absent amino acids: CIPR Common amino acids: EK
pI: 5.67 Basic residues: 5
Polar residues: 10 Hydrophobic residues: 8
Hydrophobicity: -105.81 Boman Index: -6710
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 50.32
Instability Index: 1383.87 Extinction Coefficient cystines: 8480
Absorbance 280nm: 282.67

Literature

  • PubMed ID:  11150638
  • Title:  Multiple molecular forms of glucagon and insulin in the kaluga sturgeon, Huso dauricus.